Description
Of the three GHRH approaches in this catalogue, Tesamorelin is the one that kept the full sequence. Sermorelin truncates the parent hormone down to residues 1-29. CJC-1295 takes that same 1-29 fragment and patches four residues to stop it from falling apart. Tesamorelin does something different. It keeps the entire 44-amino acid native chain and protects the vulnerable N-terminus with a single trans-3-hexenoic acid group, a six-carbon unsaturated fatty acid that sits on the front end like a chemical bumper. DPP-IV, the protease that cleaves GHRH at position 2 within minutes of release, cannot get past it.
One modification, one purpose
That trans-3-hexenoyl cap is the entire engineering story. No internal residue swaps, no albumin-binding linker, no D-amino acid substitutions buried inside the chain. Theratechnologies, the Montréal biotech that developed the molecule, kept the full GHRH(1-44) backbone because the receptor-binding work in the 1980s had already established that the longer chain folds tighter against the GHRH receptor than the truncated 1-29 fragment does. The cap solves the half-life problem without rebuilding the rest of the peptide. It is a more conservative design than CJC-1295 and a more elaborate one than Sermorelin, and the resulting plasma stability is somewhere in between.
Egrifta and Egrifta SV
This compound is the only GHRH analogue ever to clear FDA approval. The original Egrifta brand reached US patients in 2010 for HIV-associated lipodystrophy, the visceral fat accumulation that built up in long-term antiretroviral patients during the older HAART era. A reformulated version, Egrifta SV, followed in 2019 with reduced injection volume and simpler reconstitution. Both came from Theratechnologies. The clinical record behind those approvals, several central Phase III trials measuring visceral adipose tissue by CT scan, sits in the public literature and remains the most extensive prospective dataset on any peptide in this catalogue.
What that regulatory history is good for in a research setting
For lab work this matters in two ways. The pharmacokinetic and pharmacodynamic data behind the FDA submission set out clear reference values for GHRH receptor activation, IGF-1 response and visceral adipose endpoints in human subjects, which gives in vitro researchers an anchor point that the other GHRH analogues simply do not have. The synthesis route is also well characterised in the literature, so identity confirmation by mass spec is straightforward. The molecule weighs in at 5135.8 Da, sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL with the trans-3-hexenoyl group on the tyrosine.
Vial contents and basics
- Lyophilised white powder, 10 mg per vial as standard, other fills available on request
- Sequence: full GHRH(1-44) with trans-3-hexenoyl modification at the N-terminal tyrosine
- Molecular formula C221H366N72O67S, mass 5135.8 Da
- Reverse-phase HPLC purity above 99 percent, identity confirmed by ESI-MS, both reported on the batch certificate
- Sealed in nitrogen-flushed amber glass
Reconstitution and storage notes
The lyophilised material holds at minus twenty for long-term storage and refrigerated for shorter spans. Once reconstituted with sterile or bacteriostatic water the working solution stays usable in the fridge for around two weeks, though the trans-3-hexenoyl protection only shields the N-terminus, not the rest of the chain, so freeze-thaw cycles still cost potency. Make up working stocks in small aliquots and dose from those. The peptide is moderately hydrophobic for a GHRH analogue and benefits from gentle swirling rather than vortexing during reconstitution.
From our freezer to your lab
Material is held in Hertfordshire and shipped on Royal Mail Tracked 24. Roughly nine in ten UK orders placed before mid-afternoon land the next working day. The batch CoA matching the vial in front of you is posted with the product listing as a PDF and a fresh copy goes out with the shipment. If purity comes back below spec on independent assay, send the trace through live chat and the refund clears the same shift. Bulk orders past ten vials are routed through the support inbox so the price reflects the actual lot rather than a list rate. Chat is staffed by people who can read a HPLC chromatogram during UK business hours.
Sold strictly for in vitro laboratory research. Not for human or veterinary use. UK 18+.
